TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A4G3R9|A4G3R9_HERAR Putative uncharacterized protein OS=Herminiimonas arsenicoxydans GN=HEAR0973 PE=4 SV=1
MKLLRGSVPAALSVCCASTWAMHPMVTDDTATQGRQRSQIEINTDWVRGRGYDGRIADFTYTYGLSDSVDIALDMPSNLS
SPAGLNDVAIGFKWRFAEMDGISFAVTPTLALSTGSEQRGLSNGTYNPGAALIGSYATGSWVWLANVGIVSNRYRQNELR
AANRAIIRRASLAVTYAIDPQWTVVADTGIAQNMRRSEQGNPAYFLFGAVYSPNQTIDLDAGIKFGLKNVGPSRQVGVGL
TVHF