TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A4VYG6|A4VYG6_STRSY Predicted membrane protein OS=Streptococcus suis (strain 05ZYH33) GN=SSU05_2188 PE=4 SV=1
MKKIFTKTSIYYLLSFLIPLTIISIVLAFQGIWWGSDTTILASDGFHQYVIFNQTLRNTLHGDGSLFYTFSSGLGLNFYA
LSSYYLGSFLSPIVFFFDLQSMPDAIYLVTIVKFGLTGLSTYFSLKGIHKNLKEEWALLLATSFSLMSFSTSQLEINNWL
DVFILLPLVLLGLHRLLKKQGPILYYITLTCLFIQNYYFGYMVAIFLTLWTLVQLSWIDSQRIKRFINFTIVSILSALSS
MFMLLPTYLDLKTHGETFTKIVNLKTEDSWYLDFFAKNLVGSFDTTKFGSIPMISVGLVPLILALLFFTLKEIKPTVKLS
YALFFTFIISSFYLQPLNLFWQGMHAPNMFLYRYAWALSITVIYLAAETLVRLRQVSIKNFTLIVSFLLICFTSTFIFRD
HYEFLTDVNFLLTLEFLIAYFILFVAMIRYKSSLKWINIVLLFFTFLELGLHSHYQVQGISDEWHFPSRSNYEEKLTDID
SIVKSTKTTTDSFYRIERLLPQTGNDSMKFNYNGISQFSSIRNRASSSVLDKLGFRSDGTNLNLRYQNNTIIADSLFGVK
YNLATTDPNKFGFTLNQSQSTINLYENSFNLGLALLTEGIYKDVNFTNLTLDNQTNFLNQLTGLSQKYYHTLSDVVSQNT
VELSNRMTVNKVDNEDAAKATFLVNIPANSQVYLNLPNLTFSNENQKKVVITVNNQSSEFTLDNAFSFFNVGSFTTDVQV
QVNVYFPENNQVSFDKPQFYRLDLLAFQQAISILQEKQVVTKTDGNKVTVDFVTDKESSLLLTLPYDKGWNATIDGKPIK
IQKAQDGFMKVDVSPGQTKLVLTFVPNGFYLGLLISFGAVFVFFSYQFIGYYYSKNREY