TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A5V2B6|A5V2B6_SPHWW Uncharacterized protein OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=Swit_0059 PE=4 SV=1
MFARFLGWLAMALPAAGAAAEMRDYCPDRPGLGTPACTIDRGHVSVEVGLADWTLDRQAGERDDRLLLGDLLVRYGIGDR
TEVQFGWTSFGREHDRDRSAGLRLRESGVGDVTVALRHNLLHPDGSALSVALMPFATLPVGREPIGAGDWGAGFRLPVSY
EIDETFALEWVPEVDAAVDSDGKGRHLAYGTVAGVAAKLGPTLSATLEYQFTRDRDPSGHESQQLGGLSLAWQPRDDLQF
DIGANGGLDRHAPDVELYVGVSRRF