TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A5W3Z9|A5W3Z9_PSEP1 Protein involved in meta-pathway of phenol degradation-like protein OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=Pput_2725 PE=4 SV=1
MKQLRYLMLAAAVPSVCVQAFEVDPGDYEALPVGATIGVVYYQHSTTDSAYANGHKVSSDFKLTSNVGILRLLHVYQLTD
RLTLEPQFLLPFGRVSSSGDASALGDTSGVGDLTLTAPLKYRLNEANDILGATVYLTAPTGNYNRDDALNLGENRWKVDL
QAAYVKHLGEKWAVDLVGDAIWYSDNDDFGSSSARREQDVSYGAQLMGRYIVDPGTSLAIGLGHTWGGENQIDGTAQDDR
AETTNFRVTANKFFTAKDQLQMQLGRDLAVENGPKENFRLNLRYVRVF