TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A6CYR9|A6CYR9_9VIBR Putative uncharacterized protein OS=Vibrio shilonii AK1 GN=VSAK1_16007 PE=4 SV=1
MKFNILAVSIACATMSFGTMAADIKAGPGTLTLGGNMRIDMNATKQSVDLKTSTTKLKSDKTTLNTNGRLSFTADYIVEQ
NGYKMKARVNPLLKTDGTVTMDDAYLDLKKTGNTYLGAQLGRFEALDLSPLQIDIFVDDADTASLVDGELFAGHYRGNKY
RGRFDGAALLYAGNDLIKFETNVVFVDQKDKNSNVALRPVLTVTPSKSFSISAGLEKGFDDASKDKDELGLATTANVKFG
LASLNLSYAYKTSKPLLKGTSTRVDTKLHTFGTNIAAYGFGLGAFYTTANNEVKNGSVGDVNLFTTYAGYEHKDFLVDSL
TASTGAYYTSAKADKVSGDVSEYGARVRLQYNF