TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A6NST6|A6NST6_9BACE Putative uncharacterized protein OS=Bacteroides capillosus ATCC 29799 GN=BACCAP_01265 PE=3 SV=1
MPLLPIWTAWKPDDSRGEPPVRLPLFVKEEPMNATILHESRGRIRIRLKQNRMTLEQADRLELWLQNKAWARRVTVHERT
CCIILQYEGDRQAVLDDIRCFSWEKAEQQISLPAHSTRALNREFEEKLVSKVMMKAACTLFLPSPLRIARIVWHMIPFVR
RGLHCLLRRRIKVELLDALSISISACRGDFGTAGAVMFLLELGELLEEWTRKKSVEDLARCMSLNVDRVWLRTSEGEVLI
PISQVQPGDAVVVRAGGIIPVDGVLLEGEITVNQASLTGESIPVPKRPGGAVYAGTVVEEGECVLEVKKASGQSRYDQIV
HMIEQSEQMKSAAESKAAHLADKLVPYTFAGSLLSFVLTRNVARALSVLMVDFSCALKLAMPLAVLSAMREAGDAHITVK
GGKFLEAVAAADTIVFDKTGTLTHACPKVAKIIPFGGKDEREMLRVAACLEEHFPHSMANAVVEEARQQGLTHDEFHSKV
EYLVAHGIASTVNGERVLIGSAHFVFEDEHCQIPECDQERFDILPPEYSHLYLAVGGQLAAVICISDPLREEAKDVLATL
RALGISNTVMLTGDSHRTAAAIAAQVGVDDFRSEVLPADKADYVAQLRREGHTVLMVGDGINDSPALSEADAGIAISDGA
AIAREIADITIAADSLWELVELRRIAMALMARIHSNYRFVIGFNGALIALGMAGIIPPATSATLHNLSTLGVSLRSMSPL
PHQKERKQVI