TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A7IUR5|A7IUR5_PBCVM Putative uncharacterized protein M535L OS=Paramecium bursaria Chlorella virus MT325 GN=M535L PE=4 SV=1
MSAFKAIISDRDTELAKNFEFDAYLNTSLDGIAADTIEGRKETYGINSVPKTPPKSIWRIMLNTMSDPLLGLLAISATIA
TIFGIVFEEQKKNSEWIEGIAIWFTIIVIVAIGSYNDFKQDRAFHKLNSENDTYMVKVIRDGNEMQISNKELVVGDLVIL
SAGDNVPADGYLVTTNKLGLDESALTGEGITIFKNFETDPWLRSGSVVTEGIGSMYVIAVGQNSEFGRTLALVQKESGKT
PLQKRILRFVKWCGIVALCVSMSVFIAQTVRWSTMDPRPPVSSGPLKYIVFSITIIVVGLPEGLPAAVMITLTYSVKKML
QDNLFVRHLSACETLGSTSMLLSDKTGTLTENKMSVVKCVLNNTMFDHTPPIGNMKALFEDILMNCSINSSAFLTEAHGV
GSQTEVALLRFVDSYSNHLTIRENNTPTEITPFSSKTKMSSVVVNGKTYLKGAPEIVMETCSHVATIEGDIVMSDEIRKS
HMGHVRMMASSGLRTIALLRDDVLLAIFGIKDPVRRSVPAAVKMCESAGIGIIMVTGDNIDTAKHIANDIGMMKHGDIAV
EGKDFRKMSREERVAIAPKLRVLARSSPEDKFELVKLYKELGHVVAASGDGANDAPALKEADVGCAMGSGTDLAKEASDI
VILNDDFDSIVSGVRWGRNIMANIRAFITFQVAINIVALVVVSTAAFSRGTTPLNVAQLVYVNLVMDSFAAIGLSTSPPS
ANLMNKKPGHRDEFVITVEMLRSILPQALYQVVVQLVLFFVTPELIDISEKQLSGLMFNTFIFCQIFNFINVVSKDNIFP
IFAIFKKYIALACVFGLVALQVIIMFLIGKFFKIEKITPNMWGVSVAVGSGTALMHAIVVLTHRWLNNDDI