TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A7N5S9|A7N5S9_VIBHB Uncharacterized protein OS=Vibrio harveyi (strain ATCC BAA-1116 / BB120) GN=VIBHAR_04805 PE=4 SV=1
MNKALKLSLSAIGVFSALSANAGISIVDNEEGNFSIGGDVELNFNYQDRESNDSGDQEFNQDGRVLIEFAGEKFTSNGHY
VGVKAQPLFESTGEVNVDDAYFEFGKKDSWAIKAGRFEAYDMFPVGLDVFLEYSGDTSNELYTDGSAYTYQMKEARGRGS
DGQLMYSQNFGNLYLELSTMIGDRSDLFHEGTDGGTYHGQAITSSKDSFLVRPVVAYQMGDFSLAASMETNLVSDAVVTD
QGVDISDRTGYGLKGNWSSGDWSLNANVAYLDAVDENNFSTGVNALWKGLGIGYVYAMNEYENQEIQGWAEGDVKVSTLY
ASYEFTDVLEVENFSVLLGSYYTTVTNNLDATSSSEAFKEEDDFGARVRLFYEF