TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A7UX97|A7UX97_NEUCR Predicted protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU10610 PE=4 SV=1
MGKFAGNLARAGAEKAVAIQCGPWFKFIKLAPLTFIIPTILFLILSLAGCLSSAPTIPSLYVVALTSSSNGTLAPMQVRL
GYFGMCGDDGDTRTCLSAAGHYDPDEPQDIIHLTELLFPQVMNNSNARGAIPELQNMVLTGLDLQDQIFGKVLLTGSALF
ALGLVLMFPLKLVKKKLAKLAPGTPLTKKQQFIRRACYSTIWAGLMIVFAACIGTTETAGALGHATAHIKGSSILMKEGV
TLQVLQWMAFGFMFLFVLTMPIMLFVKRENPLDQYMSAEGIKEKAFGFAKGYAMDKVKKPKRALFFGRQKSQQEDMV