TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A8HP16|A8HP16_9CAUD Putative uncharacterized protein OS=Thalassomonas phage BA3 GN=BA3_0022 PE=4 SV=1
MDKNMPQDTLSFIQRIQEYGILGYAWILMISFWAGTAKYLTNLNGEKPTFLGWLTETCVSGFVGIIAAMTCQYYQLDFLL
TSAITGICAHNGTRSLYLIGQLLKKHTPILNQLAEEPAKVKLANRKGDQNGDNN