TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A8J166|A8J166_CHLRE Predicted protein OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_191336 PE=4 SV=1
MGMFSDPITARPPTNPDPSLINEDFSPTTQDKRTFDTTDYATFWITLVISITTYYLAASLVDLGMSWWQGILTVFFGNLI
TLLPMVLNAHPGTKYGVPFPVLARASFGIQGANLPSLSRAIVACGWFGIQTWIGGSSIFQMLMAVTGGAVAAAPIAWLGI
SLPELLCFLGFWAAQVWIVVRGMESIRILEKYSAPILIGLSLALMGWAVTTAGGFGPMLSTPSQFGVGMPKEGQFWSVFW
PAVTANVGYWATLSLNIPDFTRYAKSQKDQVMGQAIGLPLFMALFTFLGLAVTSATVVIYGEAIIDPVQLLGRMEGLVPI
CISLFGLMWATLTTNIAANVVAPANAFVNCAPKWISFEAGGILTAVLGLLMCPWNLVSSTHGFVNTWLIGYSALLGPVIG
IVMSDYFIVRQRQLDIDSLYSKGDKSIYWYKGGWNPAALWAILIGVLPTLPGFLSTIGVLSGLPPIFGQLYDLAWFVGVA
VSSVVYCLLMRGAPGAYKSGGDPSFNGVGGGLDTEPPGDMTIDTILVF