TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A9GNN3|A9GNN3_SORC5 Putative membrane protein OS=Sorangium cellulosum (strain So ce56) GN=sce3444 PE=4 SV=1
MRTTRWLGMAFAVSLLAASAGCAVEPQQQTAKAPAPPPAPPPPAPPAPPPDADGDGVLDDGTDKCVAEKEDGLPPDAKDG
CKSTDPDGDGLVADADKCPTEAEVKNGYKDDDGCPDVPPVVLDGNEVKLNEKIAFVAGKPEFEPASQGLLANVAQILKDH
PQIQFVEVAAYSEKVGNDAATVTLTKKRAEAVVKALTALGVEKNRVRAAGYGAHCATDPGETEEAKEKNRRVEIKIMRLD
GKDTGVELACAAVATKGLKPAGVPATAPKGAVKASDAKPVDPKAAAAPPAAAKPADAKPAAAPAAPAPAAAPPAAAQPAA
AAPAPAAPAAAKPADTKPAAAKPADTKPADTKPASVK