TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A9WJX6|A9WJX6_CHLAA Cobalt transport protein OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=Caur_1197 PE=4 SV=1
MHTRTWLCWLIATTTIAILAPHPLYHILLMLVVTQVFVRHRDDRPLARSFSLFARVGALIWFGYVVFSVVTVGGVRGATV
LLHLPAIHLPVWLGGIVLGGPITAEALAWGATRGLGLWTLLIIFGAFNALVDHHRLLRLTPRSLFHAGLAVTIALSFAPS
LVHAIQDITAAQRARGHRFGSVRSWWALIGPLLAGSLERSLQLAEALEARGYGRTLSAAHNPTRVFALIAGLLSMTTALI
GWLWVGPVSWPFALPVGGGGLVLTAWAAYDLSRCVPRTTYRRERWRRLDTLTWIAAAAAVTVVATIHLIDPTILVYYPFP
VITEPGFDLRVGAAILLLAVPALPLTAGVPRRAYRVRADRRAARQETVSQHVLSAQS