TCDB is operated by the Saier Lab Bioinformatics Group
>AAO18426.1 plantaricin NC8 beta peptide precursor [Lactobacillus plantarum subsp. plantarum NC8]
MNNLNKFSTLGKSSLSQIEGGSVPTSVYTLGIKILWSAYKHRKTIEKSFNKGFYH