TCDB is operated by the Saier Lab Bioinformatics Group
>AKM83896.1 ABC transporter-like protein [Candidatus Campbellbacteria bacterium GW2011_OD1_34_28]
MNSILKTKKIIKHFDGVKAVDGLSVEIEKGKITGLIGPNGSGKTTLMNLLTGMFPFDGGFVAVDGVSGIKKIRSYDIPAF
GITRTFQDVRLFEQMTVLDNILVVLTERNIVSALFERHKKIHHEKAKEVLERVGLWEKKNELAINLSYGQRKLLEIARAL
AMNSEIYFFDEPFAGLFPEMVKLVSGIIKELRTHGKTVVLIEHDMGLIRELCDYVFVMESGKLLAEGEPEKVLKNKDVIE
AYLGE