TCDB is operated by the Saier Lab Bioinformatics Group
>AKU99324.1 putative transmembrane protein [Labilithrix luteola]
MFRQLGTARSDRQNRLLAGYLAFVGGYVNSVGFLLVGSFTSHVTGNIGRAANDLAGAQFGAAVAALTMTLAFCAGAFLSS
VMVESTFFGKTSRAYAVALAGEGALLIAFMIFSSASFQTHPRVRDAEALLLCAAMGMQNSLVTRLSGAVVRTTHLTGVFT
DIGIEAARWFRFWRGQASERLGVPIVFGKNVVERPHAPKIVLLATIAGAFAIGATMGAIAVVRLHHSAMAFAVVAVLGCS
FYAALNSRDTRGPDDVRPSRR