TCDB is operated by the Saier Lab Bioinformatics Group
>ALD51314.1 plastid cationic amino acid transporter [Petunia x hybrida]
METHSSSFSNIKSYLRALSDTPNRLVRRAGSVSTCFEETSRVRARSGGDMKRSLRWYDLVGFGVGGMVGAGVFVTSGRAS
SHCAGPAVVLSYAIAGFCALLSAFCYTEFAVDMPVAGGAFSYIRITFGEFLAFLTGANLIIDYVLSNAAVARSFTGYLCT
ALGIESKLRITVNGLPDGFNEIDVVAVLVVLALTVIICYSTRESSVLNMVLTVLHIVFIVFVIVIGFTRGDTKNFTKAGD
SNHASGFFPFGASGVFNGAAMVYLSYIGYDAVSTMAEEVKNPVKDIPVGVSGSVILVTVLYCLMAASMSMLLPYDMIDPD
APFSGAFMGSDGWRWVSNVIGVGAGFGILTSLLVAMLGQARYMCVIGRSSVVPAWFAKVHPKTSTPVNASAFLGICTAAI
ALFTDLQILLNLVSIGTLFVFYMVANAVIYKRYVSVGVTNPWPTLSYLFCFSLTSILFTLLWQFAPPGKPKAFMLGACTA
IAIGVLQLFHYMVPQARKPEFWGVPLMPWIPSISIFLNIFLLGSLDKPSYVRFGFFSALAVLVYVLYSVHASFDAEEDGT
LSQKNIELVKESIENQDHTLKV