TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B1S807|B1S807_9BIFI Putative uncharacterized protein OS=Bifidobacterium dentium ATCC 27678 GN=BIFDEN_01688 PE=4 SV=1
MLMEISTATALATAIVALVAPVLTQVCKKYIPSEWVGSFAVAVAVLLGVIAIGATGGFDSAAWGVALAAVVGVSNAAYQA
VNRACGGKGSKDAIDAASIAAGE