TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B1W1L8|B1W1L8_STRGG Putative peptide ABC transporter ATP-binding protein OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=SGR_2414 PE=3 SV=1
MDATPNVSAVETVDVATEAEAVAAIDAPVSQGEPILQVRNLVKHFPLTQGILFKKQIGAVKAVDGISFDLYAGETLGIVG
ESGCGKSTVAKLLMTLERATAGEVFYKGQDITKLSGRALKAVRRNIQMVFQDPYTSLNPRMTVGDIIGETFEIHPEVAPK
GDRRRRVQDLLDVVGLNPEYINRYPHQFSGGQRQRIGIARGLALNPEIIICDEPVSALDVSVQAQVINLMEKLQDEFNLS
YVFIAHDLSIVRHISDRVGVMYLGKMAEIGTDTQIYDHPTHPYTQALLSAVPVPDPSAREGRDRIILTGDVPSPANPPSG
CRFRTRCWKAEERCATEEPLLAIPERFVAGSTPATHESACHFAEERDVVHAA