TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B2HPR6|B2HPR6_MYCMM Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium marinum (strain ATCC BAA-535 / M) OX=216594 GN=kdpB PE=3 SV=1
MSTTVGSGLLDPTMLWKSLPAAVRKLDPRTLWRNPVMFIVELGAVWSTLLAVVDPSWFAGLIVAWLWLTVIFANLAEAVA
EGRGKAQADTLRKTKADTMARLLTATGAEEQVTAALLQPGDIVVVDAGQVIPGDGDVVEGIASVDESAITGESAPVIRES
GGDRSAVTGGTTVLSDRILVKITQKPGESFIDKMIALVEGADRQKTPNEIALNILLASLTIIFVFTVVTLQPLAIYSKAN
NPGVADTVALNANGISGIVMVSLLVCLIPTTIGALLSAIGIAGMDRLVQRNILAMSGRAVEAAGDVNTLLLDKTGTITLG
NRQAGAFVHLPGVSEAELADAAQLSSLADETPEGRSIVVYAKQQYGLRARTPGELAHAQWIEFSATTRMSGVNVDGHLLR
KGAANAVADWVRTQGGEVPPELKATVEAISAGGGTPLAVAQVLDGTASVLGVIHLKDVVKHGMRERFDEMRRMGIRTVMI
TGDNPLTAKAIAEEAGVDDFLAEATPEDKLALIKREQGGGRLVAMTGDGTNDAPALAQADVGVAMNTGTSAAKEAGNMVD
LDSDPTKLIEIVEIGKQLLITRGALTTFSIANDIAKYFAIIPALFVGLFPGLDLLNIMRLHSPQSAILSAVIFNALVIVA
LIPLALRGVRYTPSSASKLLSRNLSIYGLGGIVAPFIGIKLIDLIIQFLPGMS