TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B3H6Z4|B3H6Z4_ARATH NDH dependent flow 6 protein OS=Arabidopsis thaliana GN=NDF6 PE=4 SV=1
MAEAFTSFTFTNLHIPSSYNHSPKQNSGPNHGYWLSNVNEKRERNLMRGSLCVRKALPHDLPLMAVMVQQIEGMRDIITE
KHVWHLSDKAIKNVYMFYIMFTCWGCLYFGSAKDPFYDSEEYRGDGGDGTGYWVYETVCISPFLILLGKKEKNLEMHTNY
N