TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B4EKB4|B4EKB4_BURCJ Putative hemin ABC transport system, membrane protein OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) OX=216591 GN=hmuU PE=1 SV=1
MPAHASPFNAPSSASRAGAARLGTSRRFAPFVLAALAILMGAMSVVALCVGAYRIPLAEAWAALSGDPAAQQARAVLLDI
RAPRVVLALLVGGGFGATGAAMQALFRNPLADPGLVGVSSGAALGATTLIVLGPALFAAHASAAALPVAAFAGGLAVAAL
VYRLAASRGRLALPLLLLAGIAINALVGAAIGLLTFVADDAQLRSLTFWSLGSLGGAQWPTLAAVAPCVALGGVLLVRER
DALNALQLGETEALHLGVPVQRLKRRVLVAVALAVGALVSCAGIIGFIGLVAPHCVRLACGPDQRIVLPGAALLGALLTL
AADLAARTVAAPADIPLGVLTALLGAPFFLALLWKNRGALGG