TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B6AF79|B6AF79_CRYMR SbmA/BacA-like family protein OS=Cryptosporidium muris (strain RN66) GN=CMU_032550 PE=4 SV=1
MIAAYLWNRKYFLRAYLLFFSSLLLMWYESSTRISMSIFVAEYNQILSDCVTARIKCEVYETTMVVIKGIVPIALSLAVC
YSINSYVVNVFIFYWRQALSEYYLSSWPLVRGIEGASQRIQEDTKAWAKLCQATITDLIQNLMMGIQILPKLIELASSVP
EIFIFGKVKYAALYPPTLLFLAQFLVILLTSVKLPYLHYENQKIEAALRKELVLAEDNNNSIDNNLIKSITSDLQRNYYA
TFRWNFPFAFGNLACREAMIFIGSIFLWPSFFSGTMTISDYYSLDLYMMQLLNVLQVIQRRWREFTEIMAIYRRLSDFEN
KIIANKNSNVDNMEKIGLLDVNLE