TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B8B381|B8B381_ORYSI Uncharacterized protein OS=Oryza sativa subsp. indica OX=39946 GN=OsI_21801 PE=4 SV=1
MASAAPLPPTPPPSQQQQPQPQGKEQQQQMAVAMNARRLVMIGDRLRTHFRGGGGTVLEPPDLAHLVYAFARGIDFALSS
GDVPTVASEIPSILKKVYLVGKDQFLQSSVMVLMISCKNACSEKWFQPTDCTEILRMANELSGKFCTPVSQPDNDSTVIQ
IISTIMPRYYPQLKFERLVTSLEAKVGYDVLMADFFIHKNVPREEKINLIVVQKEDLDASSCIANPPHVSFLVNGKGVDK
RTNVSMETGPQFPTDITRMLKYGANIIQAIGYFNANYIIAVAFLNKLESFDAPNLNDYAQPVAANPPDSDLLEGPSRVSL
KCPISFRRIKTPIKGRLCKHYQCFDYDNYMEMNLRKPTWRCPFCNTPSNFTDLRIDQKMVKILQETGEDTIDVLVFADGS
WKAISTNDERSDRHSSDVIQHSRDTMDTDATADDVIDLINEDNDGDVPMSFTSASEDVKPFLNCQDLSVADYLSDLPMNT
VSQAEDLYAGGASRGNNERGNATSTSGQNSSLPSTGGLGSSSFGTLESILPHNILHPVITDAVSPSLDTSNSVVPRQHVA
QGTRSDIVPSQPRIDPQLRLEIARPPIPRNVAREPTGIQALPVQPQRVRPNIYNCPPPFPQSSPASAYQVHQVTNADSVI
TAMSTGIGSLSRAPDAAPLLQHQSTQQEIRATQNYHQGQFIGLTAAQNFMGTRPPPGVPGQAIGANAHGAPPAQQSHHVH
RLVSNLMNQLGQATVAQPSTAPQVLPSQPGGTSAVNPQIRGHLFPAQQRSQAMRPQAVPRPTISQAPPRAQSPFLPATAR
PPSTPPPIGTSDDLQELPVDESWRPTGQMRGSLTGEAYSVAIGRYNPSVNIAGQQTSHVTSQARPAGPDARSFRRLREPS
EGANALN