TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B8H229|B8H229_CAUCN Inositol transport ATP-binding protein IatA OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=iatA PE=3 SV=1
MTLLDVSQVSKSFPGVRALDQVDLVVGVGEVHALLGENGAGKSTLIKILSAAHAADAGTVTFAGQVLDPRDAPLRRQQLG
IATIYQEFNLFPELSVAENMYLGREPRRLGLVDWSRLRADAQALLNDLGLPLNPDAPVRGLTVAEQQMVEIAKAMTLNAR
LIIMDEPTAALSGREVDRLHAIIAGLKARSVSVIYVSHRLGEVKAMCDRYTVMRDGRFVASGDVADVEVADMVRLMVGRH
VEFERRKRRRPPGAVVLKVEGVTPAAPRLSAPGYLRQVSFAARGGEIVGLAGLVGAGRTDLARLIFGADPIAAGRVLVDD
KPLRLRSPRDAIQAGIMLVPEDRKQQGCFLDHSIRRNLSLPSLKALSALGQWVDERAERDLVETYRQKLRIKMADAETAI
GKLSGGNQQKVLLGRAMALTPKVLIVDEPTRGIDIGAKAEVHQVLSDLADLGVAVVVISSELAEVMAVSDRIVVFREGVI
VADLDAQTATEEGLMAYMATGTDRVAAPDMERLTA