TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B8H230|B8H230_CAUCN Inositol ABC transport system, permease protein IatP OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=iatP PE=4 SV=1
MTAPSSPAPLATDKPRFDLLAFARKHRTILFLLLLVAVFGAANERFLTARNALNILSEVSIYGIIAVGMTFVILIGGIDV
AVGSLLAFASIAAAYVVTAVVGDGPATWLIALLVSTLIGLAGGYVQGKAVTWLHVPAFIVTLGGMTVWRGATLLLNDGGP
ISGFNDAYRWWGSGEILFLPVPVVIFALVAAAGHVALRYTRYGRQVYAVGGNAEAARLSGVNVDFITTSVYAIIGALAGL
SGFLLSARLGSAEAVAGTGYELRVIASVVIGGASLTGGSGGVGGTVLGALLIGVLSNGLVMLHVTSYVQQVVIGLIIVAA
VAFDHYARTHKA