TCDB is operated by the Saier Lab Bioinformatics Group
>BAM11099.1 ABC protein [Coptis japonica]
MNTSCKVEKHKDAKEPYGEDDSENTGREASKRSVLLDRLFSLSEKAKAGEGRTKSVPLYWLFSFADPTDIVLMTVGTVAA
LLNGLSNPLMALILGQLVDCFGQNAHTKNLLVHEVSKVSLRFVYLGIGSAAAAFFQLACWKITGERQSARIRHLYLKAIL
RQDITFFDKETNTGEVVGRVSGGVVLIQDAMGEKVGKFVQLGSSFLGGFMIAFRKGWLLVLVLMSTVPFLVLCGASMSKV
VNKLAARSQVAYSEAGAIVEQTISSIRTVASFTGERQAIRQYNRSLDTSYKSSVQEGLAAGIGFGMVMFTVFCSYGIASW
LGALFIITRTYTGGDVVCIIYAVVTGSMSLGEASPCMKAFAAGQAAAFNMFETIGRKPDIDSFDTGGITLDDICGDIELK
EIHFSYPTRPNEKVFSGFSLSIPSGTIVALVGESGSGKSTVISLIERFYDPQAGAVHIDGINLKDFQIRWIRGKIGLVSQ
EPVLFASSIKDNIAYGKDNPTMEEIRAAAELANAATFIDKLPQGLETMVGDYGTQLSGGQKQRVAIARAILRDPKILLLD
EATSALDAQSERIVQEALNRIMSKRTTIVVAHQLSTVRNSDVIAVIHQGKIVEQGSHSELVNIHGTYSQLISLQEVNQDS
EKETTNDQDDPEGSINSHQKSKHGLPDGGPLSHPLLTGSVHLPAVQENYKTESIELTTTEASQQPYKVPLHRLAYLNKPE
FPLLILGTFASVINGSILPLVGVLFSDLIYTFYEPRNRLLSDSHRLLWMFIALGFIGFIAATGRLYFFGVAGSRLIRRIR
SMSFEKVVHMEIGWFDNSQNSSSTIGTRLSMDVASIRGLLGDTLSLVVQNVSSVIIALVIAIEANWQLALLVFTLLPLLG
ASGWAYVKFTEGFSGDAKTMYEESSHVANDALRHIRTVASFCAEEKVITLYKSKCQRPRSTAIKLGVMSGIDYGISFFLL
FAFYAISFYVGSRLVEDGKTGFSNIFRVFFALCMAGIGISQRSSLATDATKTKACTASVFAILDRKSEIDPSDSSGMTLE
KVKGEIIFQHASFTYPIRPDVQILRDLCFTVEPGKTVALIGESGCGKSTVISLLQRFYDLDSGQIMLDGIAIKNFQLRWL
RKQIGLVSQEPLLFNDTIRANIEYGKEGESSEAEIIAAAKAANAHKFISGMKQGYDTVVGERGIQLSGGQKQRVAIARAI
LKSPKILLLDEATSALDAESERVVQDALDQVMINRTTIVVAHKFYTIKGADSIAVIKNGVIIEKGRHEDLLNIKNGVYSF
LVAHQMSS