TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C1C6A0|C1C6A0_STRP7 Cell division ATP-binding protein FtsE OS=Streptococcus pneumoniae (strain 70585) GN=ftsE PE=4 SV=1
MSIIEMRDVVKKYDNGTTALRGVSVSVQPGEFAYIVGPSGAGKSTFIRSLYREVKIDKGSLSVAGFNLVKIKKKDVPLLR
RSVGVVFQDYKLLPKKTVYENIAYAMEVIGENRRNIKRRVMEVLDLVGLKHKVRSFPNELSGGEQQRIAIARAIVNNPKV
LIADEPTGNLDPDNSWEIMNLLERINLQGTTILMATHNSQIVNTLRHRVIAIENGRVVRDESKGEYGYDD