TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C1GLC0|C1GLC0_PARBD Uncharacterized protein OS=Paracoccidioides brasiliensis (strain Pb18) OX=502780 GN=PADG_08056 PE=4 SV=2
MASTGQDTADLQRVIAIVKSLLNSQLKDILRSENLPVSGVKVVLQDRIIDRLERLFRAGQTDRYNQLKRFVYATAHLQIP
LTPTQPSPTYQQHQPAQSPYAQQTAASLSVPMTPSHSFSTGRLSFKDSPFYSIIDPLTPVVECKIRQDTRDSVNLKVVLS
PPIVARLQNDPSLRIMVYCAVDSGLTQYTKCDIAFPHQVELKANLDDVKANLRGLKNKPGSTRPADITNFIRKKPGYINH
VVMTYALTQKRHFVVINLVRKHSVEQLVKQLQSRKIISSEQVIREMKNRAEDADIVATSAVMSLKCPLSTLRIAVPCRSM
ICAHNQCFDATSFLQLQEQAPTWTCPVCNKATSFESLQIDQYVDDILRSTPTGVDQVTLEPDGKWYMQKDNENSTLGGNP
SPSSDDGDDLIEIQDSHPVTLKQEQTTAPLTLQRTPSVQSRAVSSVPSASRPTPNNNKRPASKVIDLTISDDEDEPPPRA
AKRPHIQSSQYLRNRHSEFAARTSLSNGGYALSSQSNSNSPAPSSFYYDT