TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C3K1P0|C3K1P0_PSEFS Hypothetical membrane protein OS=Pseudomonas fluorescens (strain SBW25) GN=PFLU_5082A PE=4 SV=1
MFHFFILSIWLYWDFAPEIPLILSSLILLLCYWRMESFVPYPLHNRNNKSTSRIQKFIELPFWYVVMVGLYVYLDHMFNF
KNRLETQDIYKPVLWGYGAFFALCIIGPLLSHSAITIIKGVVKSAQEIKNLMARVLSVFYAYMAVAIVFSALYRLLEHNN
QKSFSASFGSWFDAIYFSFVTITTVGYGDIYPVTMPAKIMVVLEVLLGLLFLVIMLATAISISFHESVITSPKDE