TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C5NSW8|C5NSW8_9STRA Aureochrome1-like protein (Fragment) OS=Chattonella marina var. antiqua OX=859642 GN=CaAUREO1 PE=2 SV=1
ERSVDELNSDCNGPLTELLFDSSAGKRRDAHLGSNETSLLEDIDNVLSEIFVLDEEENSDFSLPESISSLDNPSNQTNLF
SSASNPLHTGIDNIVSSSNPPYIQDLILQIENLRNDSSLIHDHNNFIQSVAPRKRQKHSPSSKSMMPMAGEDSSSTADQM
RKQRNKEHAKRSRIRKKMLLDSLQKSIDLLEKENLKLRNTISNALGDEAKALLYTHQPCISLIANDPSQGKVLEDPDFSL
VTALQTAQKSFVLTDPSLPDNPIVFASPGFLEMTGYTVDQVIGRNCRFLQGPDTNPKSIAKIRRAIATGEDCSVCILNYR
VDGSTFWNNFYVSALRDINGKVVNFIGVQSEVEEEGPKPREPEAAMIRAV