TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C7TET2|C7TET2_LACRG Uncharacterized protein OS=Lactobacillus rhamnosus (strain ATCC 53103 / GG) GN=LRHM_2144 PE=4 SV=1
MKVRSSHQRIEWIDVAKGLGIIAVVLGHFYPRNTTFYESLYWWHMPLFFMIGGFFVKPTTLPTLKAFLARRFWPLLKQYF
GYGVGLILLNFIIEQRTPAFTVDYLRRLIYGGTELNGYLSVFWFVTVYAFSSLLFSLLRGYLPKVWHEAILMAGLFWLGF
SYPNAETVLGFPIPGNLDLVLVALPYMFVGWWLFHYARHIVTQPWFMLVALGVFAGLFVAQSRGQIDFLLYMKSHHLTDP
LLASFVPVIICGGLFAGAKTLTGTVLGDWLDRIGRSTLPIMYGHKAVGYVLEKLGDPNLLVLVAAGVTIPLFLAYAGRYV
RERWQGGGLYAFN