TCDB is operated by the Saier Lab Bioinformatics Group
>CBI71142.1 voltage gated sodium channel subunit 2 [Myzus persicae]
MSVYSSEELLDAGIIYRNKKEQLDVTIGDGMELLIRGEKNKKKKPPTSSSYNSFGMHQSSTDENYYLKDKYEYDTRSTKS
YGSHEHDPYDSESHRGSKRSLHNAEEKKDPCKEDVETNQNVLGGNDAIAAEEINDDEYKEQGPVEMVEDVFEEEEYPEDC
FPPNCYKKFPFLAGDDETPFWLGWGQLRLKTFQLIENKYFETAVITMILLSSLALALEDVHLQHRPVLQDILYYMDRIFT
VIFFLEMLIKWLALGFRNYFTNAWCWLDFIIVMVSLINFVAALLGASGIQAFKTMRTLRALRPLRAMARMQGMRVVVNAL
VQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYYKCVDIDGKTLNHEIIPDKNVCIAENYKWENSKMNFDHVGNAYLCLF
QVATFNGWMEIMRDAVDSRDTYGKQPIREINNYMYFYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKTGASLEMFMTEDQ
KKYYNAMKKMSSKKPLKAIPRPRWKPQSIVFQIVTDKKFDMLIMLFIGFNMLTMTLDHYQQTKLFTDVLERLNQIFIAIF
STECLLKIFALRYYYFKEPWNLFDFVVVILSLAGLVLSDLISKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALA
MSLPALFNICLLLFLVMFIFAIFGMSFFMNVDSHGGLDDDYNFRTFGQSMILLFMLSTSSGWDAVLDGITNEEDCDKPNL
EMGITGSCGSSAVGTAFLLSYLVINFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYEIWQHFDPNGTRYIRYDQL
SDFLDILEPPLKIHKPNKYKIVSMDIPICKGDLIYCVDILDALTKDFFARKGNPIIETVAEIGEMQTRPEEAGYEPISSS
LWRMREVYCATIIQSSWRKYTMAAKQQTADDDRSDGAASPDGRETAVLVESDGFVTKNGHKVVIHSRSSSKSSRLADV