TCDB is operated by the Saier Lab Bioinformatics Group
>CDW85019.1 family protein [Stylonychia lemnae]
MRNQQQKPEAINESQEDFCDYSFDQKTEDLNDRTENEIDNSQCDLKSESLEINDHPSFSERQFMSVDPIDFDQKCWPTTK
FFTMYQWRDLRRHKCHFCLALCSVFIIVLSTLIVTSVVNKGPVIFLKMAEANHGEIDAFISPAGYDFPTQTKQQEFLNFT
AVQQAIKPKSFNLSPRKLFCGTRLTKIDRDREKEMLKLQKPIQQKTDQTKTERAFLKVQDPNMSIENQNQNGKFIGDIAH
LEIKIENLYRQFIKNYNNQENLTEEMKIDQPKYFEFTKTQCKIKATIDQSYGKFREDDMENLLIMEYSEFMNQIIQRLPN
EILRHQDLRDYIDKQENVRLDHYADHLVMTMPYPRINWYSNSNYDDTQNYVIEHINQLVKTVGFYPVQVKTFLLKEMMKY
NIALLLFSLIFNLVLLIFIVISILLIYSLIMIGVEQKTFETGIMRMVGISKKGLILMVLLQSSMFVTPALILALVMSIPS
LAIGYSYVFDESEGNGYEPYPTFRAIFFSFIVGVLIPILSSIIPLMKVMSQNLTEALSYERSRVKAIYIEILRADKVHLL
PQIAFGILTFIYGLLIYYVLPLSMLTYNLGLILDLFFLILMGMLFGLCVIAINLQNTLEIILTYIFLFWEKKSMKLMVLN
NLKAHLVRNRLTASIFSMALSFIIFVMVSYKLQMQNRDSSRNNWYGSVPTFGSRNQKAINPVYIDPVLRRNANIIDSFTY
FTYDMHEMDDSLVGRTMITNRARVQQFKINLNGVQPNIFEPSEGNFLDLAFKSTGLSIGEQLYSSRGNQGAAIGTFILKT
LMQEPSRQNWDKQVRIELYLENSQFVKYQLRPVVMLNQAPMFQMTDREEISPKYGHSMLVSLPMFTHYAGVNLDQLKYQR
VSIKLNDKATREDEQRLYFEIKRACPGIYSQQIWLASKYRDNVEQVDFIVSSLFNVIIAITMLLCFFSLSSSMSANLYDQ
SKEIAILRAVGLKKSRVIFLYIYEAFILVVASSLLGTLVGTAIGWSMTIQFSMFQRMPLQFFFPWKQLLVVFLIAIFCAI
LSTYGPVRQLMKLKIANLLKLA