TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D0H0R9|D0H0R9_VIBMI Putative uncharacterized protein OS=Vibrio mimicus MB451 GN=VII_003799 PE=4 SV=1
MPDKDPNHLSMITSIGFVAASLWGGVVAHILHIRKHKKPFLWREAMMQVVVSGFSGVLTMFLCRYVGSPEMLTGFMVGTA
GFMGSRALELFSQKFSKFVG