TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D0MCU7|D0MCU7_RHOM4 Uncharacterized protein OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) GN=Rmar_0149 PE=4 SV=1
MPYLRLRAYGLITALLCLAGSVQAQTPPLTADRPGIGIGTGVVLPETFQIEGGFAYDRAPRFNGYSFGQVLLRYGLNPLV
ELRVGLQSYRIEDYPRNVELKGVQDPTVGFKVALHDRSGLYVPSAAALFEVRLPVGDRVFRAASVQPTATLALDWPLLPG
FSISANGTFTSYWVDSRRFDEGLMTATLNVTLSEALPSGAYFGYAQLFVPGRNQHYLEGGLTLLLTPDLQFDVNGGVGLH
ERETYFIGAGLVRRFRF