TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D0NVC6|D0NVC6_PHYIT Amino Acid-Polyamine-Organocation (APC) Family OS=Phytophthora infestans (strain T30-4) GN=PITG_16675 PE=4 SV=1
MNFIRADTPSQLRQRFIQIQVTDRRFKEPSWMHPNIGGEAQFVQGHKDEIDAMREELEVNATKDKLGEWTSTSISGNAIL
SSVLFSAGQTIAKAGKLAPVTQLFVITVVYCLRWVFEEVMSAVPLNGGFYTAMLNSAPKKVAAICAVFSMLSYLSTAVVN
GVSAMNYVNESLVEIPVMGCTILLLVVFALLCLMGIAESAFVALILFVFHTFTLTLLGIFSLVYVAQHPSIFVDNMGTSL
PHVTMFGGAAEASNIVSALFLGYGTAMLGVTGFESSSQYVEEQAAGMFPKTLRNMWALSSTFNVVYSLLALAVVPLDTII
SNQSTLLSLMGRLSGGRWLEILVAIDAFGVLAGAVLTAYVGINGLFQRLAIDRVLPSFLLKVNSCRGTNHYIILVFCIVC
SSLVFILNAEVTVLSGVFALAFLSVLLSFTIACVLLKICREEIPRKTTTSWTNTCFCLVMISLGILSNAFSDVKALSYFF
IYFLAFFVVVFLMLTRVSLLKGLLYISRKLLLHFGSKQGDSTPLQQLSAGGQTFVGSVKVAKTIETVKNTPVVFFCKAAN
LPKINEAVRYVIQNEHTYCLRLVHVCEPDAPVPREFEDVVNLFDHIYPSMKIDFVAVTGAFDPAMVQWLSKSMDVPTNLM
FMRQPANENIHRVSALGVRVITD