TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D2ARG4|D2ARG4_STRRD Putative uncharacterized protein OS=Streptosporangium roseum (strain ATCC 12428 / DSM 43021 / JCM 3005 / NI 9100) GN=Sros_7630 PE=4 SV=1
MKNKWVQIGLSVASLALAATLVRFLPQIVEALTGKHVSWSQIGAQFARLSWPMVALMAVVWLASLLAYTFVLTASLPGLS
HSQALTLNAAGSAVSNLLPFGGAAGVAMTIAMTKGWGFPLRAVVVSTLSSGIWNTMFRFVLPAVGIVALLLSGQELSPAV
TNAGWVGSLSLLALVVVVAAALYWDRAAAVLGRALDAVARLLPRKVRPAEHTLSRALEKLRADTSEVVRHRWRGLTLGMI
FFLGLQWLLLVCCLQATGAYPGLAQTIAVFALSRVLTTALVTPSGTGIMEAGTVGALVFFGAPLDSATAAALLFGFWTYT
VEIPFGGLALGAWALLRRRENAASASDKEPISR