TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D2R7Q9|D2R7Q9_PIRSD Putative uncharacterized protein OS=Pirellula staleyi (strain ATCC 27377 / DSM 6068 / ICPB 4128) GN=Psta_2819 PE=4 SV=1
MSSFTTQCVAAVAACLMASLSIAADGEILRLPPVVDEPSGLGSGAGPTTELFAPIEVAAHDTSRDSADTQNSSQFLGIPS
SEKRLERLPPVSEIGPIGIERPAARNGSPSDAPSISDPLKPVRMPPVDPADNLQPLPVVEQPLPNDQRTNTSPATTAPPT
NYADWEAMVNQRAPISPVPPSMAPQLSPEASTNRWFGPPPLPGIRHDPWLVSQPAPAAEIASGTAAAVASEALVEQPLGE
APVDISQVFLRQSSSLLGQGVLQTEYGFTYSWQQADVITILPDSTIELERVRERQLQVPLTARYGWSDKLEIFCTLPVGV
ANFERSNSGANDFTTRGGLGDISAGFLWQICQQTECSPDLIYSMQCSAPTGSTPFGPSVNTASLGSGFWSISVNLNAVKS
YDPVVLFGGIGYRHEFENEFDGLIITPGETFSYSFGMGMSLNDDLAVSAELFGEFTSAALVNDVGIPNSTAEPILLQFSI
TRRKCADRSVQPFVAFGLTEDAPDVFLGVFFIRTRDTRWKCEE