TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D3SH02|D3SH02_DEHSG Putative uncharacterized protein OS=Dehalococcoides sp. (strain GT) GN=DehalGT_0090 PE=4 SV=1
MADSELVKSLVALGGVPLILGFVQLFKPFISDIRYYPLLAVAMGLVINLVASWALGVSAISDWVAVLFNGIIAGMAASGL
YSTGSTLREGPAADKNNRSTEGETDETK