TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D5ERW9|D5ERW9_PRER2 OmpA family protein OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) GN=PRU_1043 PE=3 SV=1
MKSMKSIAVALCASMVLAGCNMSNTAKGTMIGAGGGAALGAIIGKIAGNTAVGAAIGGAVGAGTGAIIGKKMDKAKKEAE
AVKNAQVETITDANGLEAVKVTFDSGILFATNKADLNASSKSSLQQFATVLKNNSACDVAIYGHTDNTGSDAINNPLSVN
RAKSVSNYLKSLGVPASQIKSVDGQGSTNPVADNSTAEGRKQNRRVEVYMYASEQMIKDANAEASK