TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D6TJQ1|D6TJQ1_9CHLR Cobalt transport protein OS=Ktedonobacter racemifer DSM 44963 GN=Krac_11223 PE=4 SV=1
MIEISRTITFGQFINNHSPLTRMDPRGKLLCLILLIIVTSLIKSFIAFAALLLFCILIQILSRISTRYVLRGFRPFLGFL
AFIFVLQVLFYTGQQQTIYWHWGMLSISLEGLHTSILVILRVLFLYYLFSMLLFTTSLVDLTDGMEALLSPLQRIGIPTN
TLVMVFIIALKFVPIFTGEIERLIKAQAARGVRFDQGNFLQRARKIAPLLVPLFLSGFKRAEALSTAMEARCYGFHRGWR
RSRRRQLTWARFDLLTSLITLLSCTLIFLASQALP