TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D6ZW64|D6ZW64_BIFLJ Extracellular solute-binding protein, family 1 OS=Bifidobacterium longum subsp. longum (strain JDM301) GN=BLJ_1686 PE=4 SV=1
MVSHNKRIVAALAAVAAMGIGLAGCGGSDTAGDTKSGSDGGVVNITYMHRLPDSEGMTLVNDIVAKWNKEHPNIQVKATK
FDGNAADMIKKLETDVKAGNAPDLAQVGYSEVPEVFTKGLLQDVTDEAAKYKDDFASGPFALMQVDGKTYGLPQDTGPLT
YFYNAAEFEKLGITVPKTADELIETAKKTAAQGKYIMTFQPDEAMMMMSGQAGASGPWYKVDGNSWVVNTQTKGSKAVAD
VYQQLIDNKAALTNPRWDASFDNSIQSGQLIGTVAAAWEAPLFIDSAGGTGAGEWKVTQLGDWFGNGTKTGADGGSGVAV
LKGSKHPAEAMEFLDWFNTQVDDLVSQGLVVAATTADAKTPQKWSDYFSGQDVMAEFKTANDNMGDFTYMPGFSAVGAAM
KQTAAKAADGSAKVSDVFDTAQKTSVDTLKNLGLSVKE