TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D8P7W0|D8P7W0_9BACT Putative uncharacterized protein OS=Candidatus Nitrospira defluvii GN=NIDE3921 PE=4 SV=1
MWGIGTGAILLGLGLGASGWATTEENEGPPKPPVPWRVTATVNYSSGSYGEATNTNILYAPLTVRRVFRDGDLSVTIPFV
SVSGTGSVRLVGGVPTRTSGTGGGAASTVSGGTGRGKNPGASPLSSTTTDSGVGDVIVRGRYYLVEEGDVAPLVAVTGRI
KVPTADADRGLGTGEFDEGAGLEFTKTIADRWLAYLDAGYNLIGDAPGTNFKNQWWYDVGVGHDVTDALHVSVFYEEYRA
LVNSVSNARDVLAVANYMVDESVHINTSLLVGLSNGAPQYGVGAGVRVRF