TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E1IDW6|E1IDW6_9CHLR Putative uncharacterized protein OS=Oscillochloris trichoides DG-6 GN=OSCT_1517 PE=4 SV=1
MKGRVMQGSRWKLITSVLISLGILTLAILNRTWIVEAFRVLDEAKPGWLGVAFALIGLSYLVSSQVFLVVLHSLGYRMSL
LRLWATALVAIVISQSVPAGGVGSYAFLMSNFTRRGISPGEAALLASFETLSYAVAMLIVFSFSLLFLAAHGLVTGRASY
IAALVGLCLIGAAVFLLTRRAETMRDWLIRLKNGLARLLGQQWGDAWINHIITDIDRGRGLFISRRRDVILLVFIQLIAL
SGHSLAMLLVLHSLGEQTSFLVVMAAFGIALITSTFNVLPGGGGTVEAALVAVLTQLGIGPAAVPAAIIFRLFNYWILAP
VAAACYHWLMHESVTPIRQVE