TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E1ZG13|E1ZG13_9CHLO Putative uncharacterized protein OS=Chlorella variabilis GN=CHLNCDRAFT_52596 PE=4 SV=1
MRAAKLWYLVYFAALSCLFPFLNLSFRRLGLSERSIGILGAVRPFISLPAGSLWSGAADKSRRHRAVLLLTLCASVLARL
SLAAVGRLGFAPLLAMVALTEFFAAPVTIIADAAVMAACAERGDYGRQRLWGAVGWGAFAAVSGSAISHAGVGAAFAGHA
VLAALALAPTLRLPFGPLHARLARQAGGAEAERSGSAEKEQQEQQARQEQRATGEEAAAGSADATGTPPKPPGGGRKAAV
QRFDSAFIEKEALLAGGAAAQQEGSGPGSATAAAADGGTTEQPAGGQPAVRYWRGLAQLLGDPEAAIFMAMATTMGFGVG
NIEGYLFLFLDELGGSELLMGLSLTVTCAAESLVFFFLPRLLRAGTRRCMHLVFAAFMVRMGCYAALKHAPTPWMVLPAE
VLHGFTFALAWGAGCAYCEQLAPPGLEATTQGLFQGLYFGLGQGIGALCGGWRSSAWRWRSAAGHGTCKSLAAIWR