TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E4RK11|E4RK11_HALHG Uncharacterized protein OS=Halanaerobium hydrogeniformans GN=Halsa_2167 PE=4 SV=1
MDFYLILFFLFSGIFLGWKVNKDNYFLKLSDKITKLGLVILLAAMGADLGSNEEIYRQLGRIGLQALLFAIFTIVFSVML
IYFFAKLIAGNSFNSDFKKHPDTQKNESNMTFLIFISVISGIIIGRFWLGEDFYSFLAPIINYSLALLLFGVGVDIGASR
EILEDLKLLGWKILAIPLLIAIGTLIGSVLIGVLLGFAVGESAAVGSGFGWYSLSGVLISNLHGAELGSLAFLTNVFREL
LTVILIPIVAKYFGSLAAIAPGGATTMDVTLPLIKEAGGESVVIPAFISGAVLSTLVPILVPFFLGF