TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E6N4W3|E6N4W3_9ARCH Putative uncharacterized protein (Fragment) OS=Candidatus Caldiarchaeum subterraneum GN=HGMM_F27H06C01 PE=4 SV=1
MSGAGQTLHQAVKRNLAYIAATQAFLTIIVQTFVVHVPITISLLGGSAALAGLGSALMWGGRIVTTYQMGRLMDRVGRMP
VIYSGMVVAALSAAAAAFFYQQRFMEAFLMVIVLFGVGRGMADYGRMAAGDMLPPEKRGLGTGVILTGSMVGTLAVPPII
AAVQMLSGGENIAATYLALTPFAAGGFAAAYAVKPDPLQIAKTLRQGNPSETHQQAVRKISEIINRRMVFAIVSAAVSTG
VMVAYMSLGSLLLHLGHVETTVISAVVTLHVIGMYAFSIPLGKAADIVGRVPVTLVGVIVCSIGSYIMSVGKSLDIVTIG
MFLVGVGWSAATVASIALISDETQPAERGK