TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E9BQK4|E9BQK4_LEIDB Calcium channel protein, putative OS=Leishmania donovani (strain BPK282A1) OX=981087 GN=LDBPK_340500 PE=4 SV=1
MEIPLARTQPIEKFFVEYNSAAAEREDDGQPRDDNEVLLMQFAEYTDDDSFFSSSDTVIECDPQRLRSDPLRRRAVVSVH
NTLQLRALTNGRVPEDMVWNNVTRTSWLYQIHNRAIALQHSSFFIFPARWTPRVMVYNVMHHWLMEMFIFLMILGYAIFQ
ATWSRYTAPPGGMHKPDHIIWADVFYTCLLGFEIIARLFASGGILHKRAFFRSPWRWLDTAVLVLSIMECTWWQDLWNFT
AWRLIRTIKCLTYVPAPVRMKLLAKSLLRSTNRLIYVTIFLTYFIFFFGLLGLQLFVGTLHSRCVNTLTGAVTSQVCRSV
ATGQYGFYWGHHCGVFYTCQADAFPNPHYDFRSFDDIGHAMLSVFQIMTFQGWSELLQETNDGLAMMAFLYYFFTILVCA
WIVPSLYLGVFLEKMDKTSRLFVLKQLDFFDHMLTEQRQRMSSMVRLNDYVERDENGFVSHYPAYTLQQQDDKRLTSDDS
TSGSTDDKNMNAHRIKSHHRAIQATKWTDEQRIQLQLALTRQRDVAEEAERKRQLQQAALGDLIVEEGGAGKRQGTGRRG
ASPAGAASGSATQTETSPQPTKERSEFALGGRVGAVQHHPAAYAIGDSHQSDLPFAVRQEVQAEQLRFLDPYTNGASAAK
NDMYNSAAALRTSIDQSRTAVPGGGAESATVLHSRPVSNARPSTRAPSAPSTSVMVAREAAGVVPHRRSTSVRGGTLSRA
SSMNGRGSLSRLHASMTQVPQAPTQQEQTAYVINDPEGGDFDYAKTLGQKINIIRNIAHMFTEGYPRIISQYLWEHRMMQ
HRYGLTPLSYTNKYEEEALRRLRQRRAQERREEREELRRSGMGHLIDDDEDEDDDSLAEKPWMRQEGLVPGSMSPIRMAR
NIRENAPITVFNYIMYSFIIANAVFNASRFDTMPDYWETGTFIAGVCFSVLFMLELLIRLLALGPGPFFTDIVILIEATF
MVTSLFQLGYSRANTTSLFNWVRFLRLFRVIPCRPLRRVSRVLIHGFPDMVYALVFFTLYMFMWLLLGMSFFGSRIGWID
YNTSDYTTRGTFETFSHAAYAVAQAFSVNRDQWLYLSWSGMRVRGSYTVMYFIATVCVAFIFRFFFIAVMTCAWQAQQEK
EDYYFMSGSSHGRRGRRSRFARLPFFDFSVWRSFKHIHGGFDRRDVAPDEIYFLNEDMARQLRLVEAKDRYYREHYGQEK
SEWSDMGEGSQVGGSDMYGPDGALVNGPQYVNIGGRLYRQPSLPATEMGFSVVGTPQQRGQLRFARHHRAVPATTYAAAQ
LQRPAGAHDALPDEVVGSRSLSRHSRRSMANPLLADRHSLSPAHQGTSVGGPSVARVSDSLAEERAKNTNISLVPRLTKL
GNARALVVAGDDEATADYSTPEGGVSDEDFEHLLLPGPRLRYKSTMDEGRRVFETCLDCNTHMQMPLRAPPGVAQRTAEE
LHAEHCHMAAVRSSQQLVLNALIGYTRMQADHEVTPTKRMVEIVLGQAWSCGMLLFDTIENLSCMDLPEQERTWDRMLEA
LEMQQWLLGLHVGEEQVGRATLAYILANQQRQEAQVREKSYKNTWEDRVFFVLSPSNPVRRAVSAVVGSMWFEIAVLCVV
YAASICLAVYAPDEGNRDFGGSYNSAKYKVLHILDDIFSIIFAVEMVLKWISMGVVLPVGRAYFWHRWNIFDFFIVIISL
VSWGRPDIFLRYLKVMRCFRILGPLRYWKWGSSSMSHVARAIWDSIPTLANVCLLMLMNYIVWAIIFVSLFMDKFNYCSN
ASIVNGTQCVEEGYTWAPTQRNFRNFYESLLTTFEISTGAEWIDVIYSAVDSRSALLSPLRNQRPYLGLVFIAYYYVSHF
IFFTLFISAVIYCYMLAKSATEDATGTTIEHQVWLRMQGMIFRLKPKVQLLPLDTRVSRLVHFLISNRWFEAFMGLILVF
NMLTMSLEWYQMSSTQKTTLDAFQYIWVVIFTLEVVLRFVAHGLRFFTRRAYCWDLLIVVLSYIQIGLSTTATNRVPFNV
NVLRMLRVGRVLHLVHLVLPFSTHLTLFHEVLKASVPGLISVTFVYMIAVYVFAILGLHFLGYIVPFGGYIDDKYNNFGT
FVNALIMVFRLSTLQNWATMLRGSLDRGYYCARASKRCGPTDWAPVYYIPIVICFFLLLSTLYMAVVLDKYVAAVRIYSA
VTRLDELRRFCRLWSKRDPNGTMWLPSAVLPELLEELRLPLGVSDRRNRVEVMQLLREYNIPDHNGRVYYYEVLLPLARR
VMAIAFLEAADAHTAGSQAPRDIAWHLSERSLGALPASYGTVRPSSVTVAEHYAAALLQAAFRRDRAMRDYYIAKSELWR
RGRAVCVERGLPYDNFGFGKTPLAGPDPREEGMRRGFNIPKDATLANSAGGRVYADPVAARIAAMREAMGSHKRATDQEP
PTLLPAVYRSAIYPEEKRFGPNAPGAIRRHERRDEKLERKRAQEEYERQMYERSTRGCPARTAGEQKDNETVTAEGAGDV
DVGLAYSKGTMEPHPAARGNQYNLDPMDVNYQPPLGTSPEELRQEKVDRRLNAAAAAATASATLGGISPSTTPEQY