TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F0QEP2|F0QEP2_ACIBD Meta-pathway phenol degradation protein OS=Acinetobacter baumannii (strain TCDC-AB0715) GN=ABTW07_1994 PE=4 SV=1
MKSTLIKHGFLAGTLLGLPWVTHAYDLPTVNLGMTSFLDGGLPAGPGWYAQTYFQNYDSNKLVDAKGQKLGLPKTDLNYQ
VLVEQISYLSNVRVKDKASLGINFLIPFVSKMDMDDGLNNAAIKAQSGFGDIMIGPFIQFDPVIGAQGPKFVHRFEFQVN
LPTGEYNQQKDINPSNNAVSFDPYWAATYWFNPKWTASTRIHYLYNFKNDDPSYAFAGANDMQAGQAIHANFATDYAITE
QFRLGLNGYWLKQVTDTEVDGEKVKGRREQVWAIGPGAMYSFSKNDHLVANAYFEQDTENRPEGTRLQVRYVHHF